Recombinant Human PCBP2/hnRNP E2 protein (ab116820)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15366
    • SpeciesHuman
    • SequenceMDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINIS EGNCPERIITLAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTL RLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAG IPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGS DSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQS HFPMTHGNTGFSGIESSSPEVKGYWAGLDASAQTTSHELTIPNDLIGCII GRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINV RLSSETGGMGSS
    • Molecular weight66 kDa including tags
    • Amino acids1 to 365

Specifications

Our Abpromise guarantee covers the use of ab116820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Alpha CP2
    • Alpha-CP2
    • alphaCP-2
    • Cbp
    • CTBP
    • Heterogeneous nuclear ribonucleoprotein E2
    • Heterogenous nuclear ribonucleoprotein E2
    • hnRNP E2
    • hnRNP-E2
    • HNRNPE2
    • Hnrnpx
    • HNRPE2
    • Hnrpx
    • MGC110998
    • PCBP2
    • PCBP2_HUMAN
    • poly(rC) binding protein 2
    • Poly(rC)-binding protein 2
    • Putative heterogeneous nuclear ribonucleoprotein X
    • rCbinding protein 2
    see all
  • FunctionSingle-stranded nucleic acid binding protein that binds preferentially to oligo dC. Major cellular poly(rC)-binding protein. Binds also poly(rU). Negatively regulates cellular antiviral responses mediated by MAVS signaling. It acts as an adapter between MAVS and the E3 ubiquitin ligase ITCH, therefore triggering MAVS ubiquitinationa and degradation.
  • Tissue specificityDetected in all tissues examined.
  • Sequence similaritiesContains 3 KH domains.
  • Post-translational
    modifications
    Phosphorylated. The non-phosphorylated form(s) exhibited the strongest poly(rC)-binding activity.
  • Cellular localizationNucleus. Cytoplasm. Loosely bound in the nucleus. May shuttle between the nucleus and the cytoplasm.
  • Information by UniProt

Recombinant Human PCBP2/hnRNP E2 protein images

  • 12.5% SDS-PAGE showing ab116820 at approximately 65.93kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PCBP2/hnRNP E2 protein (ab116820)

ab116820 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"