Overview

  • Product name
    Recombinant Human PCCA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSAALRTLKHVLYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIA CRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMD AIMEAIKKTRAQAVHPGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMG DKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGG GKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVL GDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDAETRRAMGEQAVALAR AVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPVTECITGLDLVQEMIR VAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLH LPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVI RGVTHNIALLREVIINSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQL LAIASSLFVAFQLRAQHFQENSRMPVIKPDIANWELSVKLHDKVHTVVAS NNGSVFSVEVDGSKLNVTSTWNLASPLLSVSVDGTQRTVQCLSREAGGNM SIQFLGTVYKVNILTRLAAELNKFMLEKVTEDTSSVLRSPMPGVVVAVSV KPGDAVAEGQEICVIEAMKMQNSMTAGKTGTVKSVHCQAGDTVGEGDLLV ELE
    • Amino acids
      1 to 703
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • mitochondrial
    • Pcca
    • pccA COMPLEMENTATION GROUP
    • PCCA_HUMAN
    • PCCase subunit alpha
    • Propanoyl CoA:carbon dioxide ligase subunit alpha
    • Propanoyl-CoA:carbon dioxide ligase subunit alpha
    • Propionyl CoA carboxylase alpha chain
    • Propionyl CoA carboxylase alpha chain mitochondrial
    • Propionyl CoA carboxylase alpha polypeptide
    • Propionyl coenzyme A carboxylase alpha polypeptide
    • Propionyl-CoA carboxylase alpha chain
    see all
  • Pathway
    Metabolic intermediate metabolism; propanoyl-CoA degradation; succinyl-CoA from propanoyl-CoA: step 1/3.
  • Involvement in disease
    Defects in PCCA are the cause of propionic acidemia type I (PA-1) [MIM:606054]. PA-1 is a life-threatening disease characterized by episodic vomiting, lethargy and ketosis, neutropenia, periodic thrombocytopenia, hypogammaglobulinemia, developmental retardation, and intolerance to protein.
  • Sequence similarities
    Contains 1 ATP-grasp domain.
    Contains 1 biotin carboxylation domain.
    Contains 1 biotinyl-binding domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab159059 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up