Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSGAGGRRCPEAALLILGPPRMEHLRHSPGPGGQRLLLPSMLLALLLLL APSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLR VDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPR LLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPN GVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTI KVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVI QVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDLSLFRARWTVRT
    • Amino acids
      1 to 345
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cadherin like 1
    • Cadherin like protein 1
    • Cadherin-like protein 1
    • FLJ53887
    • MGC45991
    • OTTHUMP00000160067
    • PC 42
    • PC42
    • PCDH 1
    • PCDH 42
    • PCDH1
    • PCDH1_HUMAN
    • PCDH42
    • Protocadherin 1
    • Protocadherin 42
    • Protocadherin-1
    • Protocadherin-42
    • Protocadherin1
    • Protocadherin42
    see all
  • Function
    May be involved in cell-cell interaction processes and in cell adhesion.
  • Tissue specificity
    Highly expressed in the brain and neuro-glial cells.
  • Sequence similarities
    Contains 7 cadherin domains.
  • Developmental stage
    Highest expression in adults.
  • Cellular localization
    Cell junction. Cell membrane. Found at cell-cell boundaries and probably at cell-matrix boundaries.
  • Information by UniProt

Images

  • ab159060 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up