Recombinant Human PCDH10 protein (ab153775)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNL ETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDN PPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFS LDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGG GGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTL VIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDY EESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVS EGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRPKSSFKNYYTIVTE APLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVY DVYVTENNVPGAYIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSI NSENGYLYALRSFDYEQLKDFSFQVEARDAGSPQALAGNATVNILIVDQN DNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTY SIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPL SSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQRPSRSGGGETSLDLTVDH HHHHH
    • Molecular weight
      76 kDa including tags
    • Amino acids
      19 to 715
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab153775 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. I is lyophilized from an 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Dissolve the lyophilized protein in 1X PBS.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • DKFZp761O2023
    • KIAA1400
    • MGC133344
    • OL PCDH
    • Ortholog of OL pcdh
    • OTTHUMP00000220001
    • PCD10_HUMAN
    • PCDH10
    • PCDH19
    • Protocadherin 10
    • Protocadherin-10
    see all
  • Function
    Potential calcium-dependent cell-adhesion protein.
  • Tissue specificity
    Moderately expressed in all regions of the brain examined, as well as in testis and ovary, and low expression in all other tissues tested.
  • Sequence similarities
    Contains 6 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab153775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up