Recombinant Human PCDH11Y protein (ab164385)

Overview

  • Product name
    Recombinant Human PCDH11Y protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPL IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVK IRFLIEDIN
    • Amino acids
      57 to 165
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PCDH 11
    • PCDH 11X
    • PCDH 11Y
    • PCDH 22
    • PCDH PC
    • PCDH Y
    • PCDH11
    • PCDH11X
    • PCDH22
    • PCDHY
    • Protocadherin 11
    • Protocadherin 11 X linked
    • Protocadherin 11 Y linked
    • Protocadherin 22
    • Protocadherin on the Y chromosome
    • Protocadherin PC
    • Protocadherin prostate cancer
    • Protocadherin Y
    • Protocadherin11
    • Protocadherin22
    • ProtocadherinY
    see all
  • Relevance
    PCDH11Y (Protocadherin 11 Y-linked) is a member of the protocadherin family. Protocadherins constitute the largest subgroup within the cadherin family of calcium-dependent cell-cell adhesion molecules. Their specific functions are unknown but they may be involved in the establishment and function of specific neuronal connections in the brain. The PCDH11Y gene is located in a major X/Y block of homology and its most closely related cadherin superfamily member is located in this homologous region on the X chromosome (PCDH11X).
  • Cellular localization
    Cell membrane; Single-pass type I membrane protein.

Images

  • ab164385 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164385 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164385.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up