Recombinant Human PCDH17 protein (ab182811)

Overview

  • Product name
    Recombinant Human PCDH17 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFLKNLNYSVPEEQGAGTVIGNI GRDARLQPGLPPAERGGGGRSKSGSYRVLENSAPHLLDVDADSGLLYTKQ RIDRESLCRHNAKCQLSLEVFANDKEICMIKVEIQDINDNAPSFSSDQIE MDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFGLDVKSRGD GTKFPELVIQKALDREQQNHHTLVLTALDGGEPPRSATVQINVKVIDSND NSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPD RVRELFSIDPKTGLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVT VKLIDRNDNAPSIGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQ CRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTVVTDRPLDRETQDEY NVTIVARDGGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPG EYLGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALR SFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTL QNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEI DPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSL PEGVPRVNGEQHHWDMSLP
    • Molecular weight
      78 kDa including tags
    • Amino acids
      18 to 707
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      Extracellular domain. (NP_001035519 ) T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab182811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • C030033F14Rik
    • Gm78
    • PCD17_HUMAN
    • PCDH17
    • PCDH68
    • PCH68
    • Protocadherin 17
    • Protocadherin 68
    • Protocadherin-17
    • Protocadherin-68
    see all
  • Function
    Potential calcium-dependent cell-adhesion protein.
  • Sequence similarities
    Contains 6 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab182811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up