Overview

  • Product name
    Recombinant Human PCDH7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNL TGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV
    • Molecular weight
      36 kDa including tags
    • Amino acids
      31 to 124

Specifications

Our Abpromise guarantee covers the use of ab116835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BH Pcdh
    • BH protocadherin
    • BH-Pcdh
    • BHPCDH
    • Brain heart protocadherin
    • Brain-heart protocadherin
    • PCDH 7
    • PCDH7
    • PCDH7_HUMAN
    • Protocadherin 7
    • Protocadherin-7
    see all
  • Tissue specificity
    Expressed predominantly in brain and heart and at lower levels in various other tissues.
  • Sequence similarities
    Contains 7 cadherin domains.
  • Post-translational
    modifications
    Isoform C is phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human PCDH7 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116835 at approximately 35.97 kDa.

References for Recombinant Human PCDH7 protein (ab116835)

ab116835 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up