Recombinant Human PCDHA7 protein (ab163339)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPL GLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPV
    • Amino acids
      143 to 241
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CNRS4
    • PCDA7_HUMAN
    • PCDH alpha 7
    • PCDH-alpha-7
    • PCDHA7
    • Protocadherin alpha 7
    • Protocadherin alpha-7
    see all
  • Function
    Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
  • Sequence similarities
    Contains 6 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab163339 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up