Recombinant Human PCDHGB1 protein (ab163311)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQRAREAEMMKSQVLFPFLLSLFCGAISQQIRYTIPEELANGSRVGKLAK DLGLSVRELPTRKLRVSAEDYFNVSLESGDLLVNGRIDREKICGRKLECA LEFETVAENPMNVFHVVVVIQDINDNAPRFVAKGIDLEICESALPGVKFS LDSAQDADVEGNSLKLYTINPNQYFSLSTKESPDGSKYPVLLLEKPLDRE HQSSHRLILTAMDGGDPPLSGTTHIWIRVTDANDNAPVFSQEVYRVSLQE NVPWGTSVLRVMATDQDEGINAEITYAFLNSPISTSLFNLNPNTGDITTN GTLDFEETSRYVLSVEAKDGGVHTAHCNVQIEIVDENDNAPEVTFMSFSN QIPEDSDLGTVIALIKVRDKDSGQNGMVTCYTQEEVPFKLESTSKNYYKL VIAGALNREQTADYNVTIIATDKGKPALSSRTSITLHISDINDNAPVFHQ ASYVVHVSENNPPGASIAQVSASDPDLGPNGRVSYSILASDLEPRELLSY VSVSPQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGD LNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWL SYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPL SATATLHLIFADSLQEVLPDLSDRPEPSDPQTELQFYLVVALALISVLFL LAVILAIALRLRRSSSLDTEGCFQTGLCSKSGPGVPPNHSEGTLPYSYNL CIASHSAKTEFNSLNLTPEMAPPQDLLCDDPSMVVCASNEDHKIAYDPSL SSHVSFCKSS
    • Amino acids
      1 to 810
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC119466
    • MGC119467
    • MGC119469
    • PCDH gamma B1
    • Protocadherin gamma B1
    • Protocadherin gamma B1 precursor
    • Protocadherin gamma subfamily B 1
    see all
  • Relevance
    The PCDHGB1 gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
  • Cellular localization
    Cell membrane; Single-pass type I membrane protein.

Images

  • ab163311 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up