Recombinant Human PCDHGC3 protein (ab159063)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLELVVENPLELFS VEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQ TYELSRNE
    • Amino acids
      71 to 178
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cadherin like 2
    • PC 43
    • PC-43
    • PC43
    • PCDGK_HUMAN
    • PCDH 2
    • PCDH gamma C3
    • PCDH-gamma-C3
    • PCDH2
    • PCDHGC 3
    • PCDHGC3
    • Protocadherin 2
    • Protocadherin 43
    • Protocadherin gamma C3
    • Protocadherin gamma subfamily C 3
    • Protocadherin gamma-C3
    • Protocadherin-2
    • Protocadherin-43
    • Protocadherin2
    • Protocadherin43
    see all
  • Function
    Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
  • Sequence similarities
    Contains 6 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab159063 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159063 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up