Overview

  • Product name
    Recombinant Human PCF11 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNEL QEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV
    • Amino acids
      1465 to 1555
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hPCF11
    • KIAA0824
    • OTTHUMP00000234826
    • PCF11
    • PCF11 cleavage and polyadenylation factor subunit
    • PCF11, cleavage and polyadenylation factor II subunit, homolog
    • PCF11, cleavage and polyadenylation factor subunit, homolog (S.
    • PCF11_HUMAN
    • PCF11p homolog
    • Pre-mRNA cleavage complex 2 protein Pcf11
    • Pre-mRNA cleavage complex II protein Pcf11
    see all
  • Function
    Component of pre-mRNA cleavage complex II.
  • Sequence similarities
    Contains 1 CID domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153356 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up