Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSE EENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQR DTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLG SPLSKIGIELTDSPYVVASMRIMTRMGTPVLEALGDGEFVKCLHSVGCPL PLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRM ASRLAKEEGWLAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL PGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKT IQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCA HPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSW QHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSM AQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKAST KLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQV NADLPCEIEREILALKQRISQM
    • Molecular weight
      95 kDa including tags
    • Amino acids
      1 to 623

Specifications

Our Abpromise guarantee covers the use of ab114362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cytosolic [GTP]
    • GTP
    • PCK1
    • PCKGC_HUMAN
    • PEP carboxykinase
    • PEPCK-C
    • PEPCK1
    • PEPCKC
    • Phosphoenolpyruvate carboxykinase
    • Phosphoenolpyruvate carboxykinase 1
    • Phosphoenolpyruvate carboxykinase 1 (soluble)
    • Phosphoenolpyruvate carboxykinase, cytosolic
    • Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
    • Phosphoenolpyruvate carboxylase
    • Phosphopyruvate carboxylase
    see all
  • Function
    Catalyzes the conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP), the rate-limiting step in the metabolic pathway that produces glucose from lactate and other precursors derived from the citric acid cycle.
  • Tissue specificity
    Major sites of expression are liver, kidney and adipocytes.
  • Pathway
    Carbohydrate biosynthesis; gluconeogenesis.
  • Involvement in disease
    Defects in PCK1 are the cause of cytosolic phosphoenolpyruvate carboxykinase deficiency (cytosolic PEPCK deficiency) [MIM:261680]. PEPCK deficiency is a metabolic disorder resulting from impaired gluconeogenesis. It is a rare disease with less than 10 cases reported in the literature. Clinical characteristics include hypotonia, hepatomegaly, failure to thrive, lactic acidosis and hypoglycemia. Autoposy reveals fatty infiltration of both the liver and kidneys. The disorder is transmitted as an autosomal recessive trait.
  • Sequence similarities
    Belongs to the phosphoenolpyruvate carboxykinase [GTP] family.
  • Post-translational
    modifications
    Acetylation is increased on addition of glucose and appears to regulate the protein stability.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human PCK1 protein images

  • 12.5% SDS-PAGE showing ab114362 at approximately 94.53kDa stained with Coomassie Blue.

References for Recombinant Human PCK1 protein (ab114362)

ab114362 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up