Overview

  • Product name
    Recombinant Human PCLKC protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTS VLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLL EADEEVQLQ
    • Amino acids
      210 to 318
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20124
    • FLJ20383
    • MGC163154
    • PC LKC
    • Protocadherin LKC
    see all
  • Relevance
    PCLKC (Protocadherin LKC) belongs to the protocadherin gene family, a subgroup of the cadherin superfamily. It is predominantly expressed in liver, kidney and colon tissues, and has a role in contact inhibition at the lateral surface of epithelial cells. It is a candidate tumor suppressor.
  • Cellular localization
    Apical cell membrane; Single-pass type I membrane protein. Cell junction. Note=Present at the cell junctions and the apical surface of cells. Colocalizes with actin at the microvilli-like structures which protrude from the apical surface.

Images

  • ab162851 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up