Overview

  • Product nameRecombinant Human PCM1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEKNKK KFGVESDKRVTNDISPESSPGVGRRRTKTPHTFPHSRYMSQMSVPEQAEL EKLKQRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQINT NKSKDASTSPPNRETIGSAQCKELFASALSNDLLQNCQVSEEDGRGEPAM ESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLTHLIDHLKEQE KSYMKFLKKILARENEEEDVRTIDSAVGSGSVAESTSLNIDVQSEASDTT ARDPQQEPMEEIENLKKQHDLLKRMLQQQEQLRALQGRQAALLALQHKAE QAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPAV PDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQKMD KLLGELHTLRDQHLNNSSSSPQRSVDQRSTSAPSASVGLAPVVNGESNSL TSSVPYPTASLVSQNESENEGHLNPSEKLQ
    • Molecular weight84 kDa including tags
    • Amino acids1 to 530

Specifications

Our Abpromise guarantee covers the use of ab114699 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hPCM-1
    • PCM-1
    • pcm1
    • PCM1_HUMAN
    • Pericentriolar material 1
    • Pericentriolar material 1 protein
    • PTC4
    see all
  • FunctionRequired for centrosome assembly and function. Essential for the correct localization of several centrosomal proteins including CEP250, CETN3, PCNT and NEK2. Required to anchor microtubules to the centrosome. Involved in the biogenesis of cilia.
  • Tissue specificityExpressed in blood, bone marrow, breast, lymph node, ovary and thyroid.
  • Involvement in diseaseDefects in PCM1 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving PCM1 is found in thyroid papillary carcinomas. Translocation t(8;10)(p21.3;q11.2) with RET links the protein kinase domain of RET to the major portion of PCM1.
    Note=A chromosomal aberration involving PCM1 is found in a variety of hematological malignancies including atypical chronic myeloid leukemia (atypical CML) and T-cell lymphoma. Translocation t(8;9)(p22;p24) with JAK2 links the protein kinase domain of JAK2 to the major portion of PCM1.
  • Sequence similaritiesBelongs to the PCM1 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Cytoplasmic granule. Localizes to cytoplasmic granules which are enriched around the centrosome. This centrosomal enrichment requires microtubules and dynein. The majority of the protein dissociates from the centrosome during metaphase and subsequently localizes to the cleavage site in telophase.
  • Information by UniProt

Recombinant Human PCM1 protein images

  • 12.5% SDS-PAGE showing ab114699 at approximately 84.41 kDa stained with Coomassie Blue.

References for Recombinant Human PCM1 protein (ab114699)

ab114699 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114699.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"