Overview

  • Product name
    Recombinant Human PCMF protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDH PMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSE HAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRAPRDLDESSGVRH VRRMFHPGRGLGGPRARRSNMHFTSSSTGGLSSSQSSYSPSNREAMDPIA ELLSQLSGVRRSAGGQLNSSGPSASQLQQLQMQLQLERQHAQAARQQLET ARNATRRTNTSSVTTTITQSTATTNIANTESSQQTLQNSQFLLTRLNDPK MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAM GCVDIMPLDVALENLNLKESNKGNEPPPPPL
    • Amino acids
      1 to 381
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DEBT 91
    • DEBT91
    • Differentially expressed in branching tubulogenesis 91
    • DKFZP434L1021
    • E3 ubiquitin protein ligase KCMF1
    • FGF induced in gastric cancer
    • FGF induced ubiquitin protein ligase in gastric cancers
    • FIGC
    • KCMF 1
    • KCMF1
    • PCMF
    • Potassium channel modulatory factor
    • Potassium channel modulatory factor 1
    • Zinc finger ZZ domain containing 1
    • ZZ type zinc finger containing protein 1
    • ZZZ 1
    • ZZZ1
    see all
  • Relevance
    PCMF has intrinsic E3 ubiquitin ligase activity and promotes ubiquitination.

Images

  • ab163410 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up