Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSP QSIGFQ ATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFAR MVGCTGKVIGIDHI KELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMG YAEEAPYDAIHVGAAAPVVPQA LIDQLKPGGRLILPVGPAGGNQMLEQ YDKLQDGSIKMKPLMGVIYVPLTDKEKQWS RWK

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88297 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • L isoaspartyl protein carboxyl methyltransferase
    • L isoaspartyl/D aspartyl methyltransferase
    • L-isoaspartyl protein carboxyl methyltransferase
    • PCMT 1
    • Pcmt1
    • PIMT
    • PIMT_HUMAN
    • Protein beta aspartate methyltransferase
    • Protein L isoaspartate (D aspartate) O methyltransferase
    • Protein L isoaspartyl/D aspartyl methyltransferase
    • Protein L-isoaspartyl/D-aspartyl methyltransferase
    • Protein-beta-aspartate methyltransferase
    • Protein-L-isoaspartate(D-aspartate) O-methyltransferase
    see all
  • RelevanceFunction: Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on EIF4EBP2, microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl-terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein. Similarity: Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.
  • Cellular localizationCytoplasmic

References for Recombinant Human PCMT1 protein (ab88297)

ab88297 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"