Recombinant Human PCMTD1 protein (BSA and azide free) (ab174387)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSH MGSMGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYR DNAYKDLAWKHGNIHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTM VGLILGPFGINHGIELHSDVVEYAKEKLESFIKNSDSFDKFEFCEPAFVV GNCLQIASDSHQYDRIYCGAGVQKDHENYMKILLKVGGILVMPIEDQLTQ IMRTGQNTWESKNILAVSFAPLV
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 220
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_443169)

Associated products

Specifications

Our Abpromise guarantee covers the use of ab174387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • PCMD1_HUMAN
    • PCMTD1
    • Protein L isoaspartate (D aspartate) O methyltransferase domain containing 1
    • Protein-L-isoaspartate O-methyltransferase domain-containing protein 1
  • Sequence similarities
    Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis PCMTD1 using 3 µg of ab174387 on a 15% gel.

References

ab174387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up