Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8WW12
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMADGKAGDEKPEKSQRAGAAGGPEEE AEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIG SQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPP EAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQ DN
    • Molecular weight22 kDa including tags
    • Amino acids1 to 178
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113147 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Ab2 416
    • AI647035
    • PCNP
    • PCNP_HUMAN
    • PEST containing nuclear protein
    • PEST proteolytic signal containing nuclear protein
    • PEST proteolytic signal-containing nuclear protein
    • PEST-containing nuclear protein
    see all
  • FunctionMay be involved in cell cycle regulation.
  • Post-translational
    modifications
    Ubiquitinated; mediated by UHRF2 and leading to its subsequent proteasomal degradation.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human PCNP protein images

  • 15% SDS-PAGE analysis of ab113147 (3µg)

References for Recombinant Human PCNP protein (ab113147)

ab113147 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"