Recombinant Human PCOLCE protein (ab114788)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVAS EGFPNLYPPNKECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAG SGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGRGFLLWYSGRA TSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNE LLVQF
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 449

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PCOC1_HUMAN
    • Pcolce
    • PCOLE 1
    • PCOLE1
    • PCPE
    • PCPE-1
    • PCPE1
    • Procollagen C endopeptidase enhancer
    • Procollagen C-endopeptidase enhancer
    • Procollagen C-endopeptidase enhancer 1
    • Procollagen C-proteinase enhancer 1
    • Procollagen COOH-terminal proteinase enhancer 1
    • procollagen, type 1, COOH-terminal proteinase enhancer
    • Type 1 procollagen C-proteinase enhancer protein
    • Type I procollagen COOH-terminal proteinase enhancer
    see all
  • Function
    Binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.
    C-terminal processed part of PCPE (CT-PCPE) may have an metalloproteinase inhibitory activity.
  • Sequence similarities
    Contains 2 CUB domains.
    Contains 1 NTR domain.
  • Post-translational
    modifications
    C-terminally processed at multiple positions.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab114788 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up