Recombinant Human PCOLCE protein (ab114788)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVAS EGFPNLYPPNKECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAG SGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGRGFLLWYSGRA TSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNE LLVQF
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 449

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PCOC1_HUMAN
    • Pcolce
    • PCOLE 1
    • PCOLE1
    • PCPE
    • PCPE-1
    • PCPE1
    • Procollagen C endopeptidase enhancer
    • Procollagen C-endopeptidase enhancer
    • Procollagen C-endopeptidase enhancer 1
    • Procollagen C-proteinase enhancer 1
    • Procollagen COOH-terminal proteinase enhancer 1
    • procollagen, type 1, COOH-terminal proteinase enhancer
    • Type 1 procollagen C-proteinase enhancer protein
    • Type I procollagen COOH-terminal proteinase enhancer
    see all
  • Function
    Binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.
    C-terminal processed part of PCPE (CT-PCPE) may have an metalloproteinase inhibitory activity.
  • Sequence similarities
    Contains 2 CUB domains.
    Contains 1 NTR domain.
  • Post-translational
    modifications
    C-terminally processed at multiple positions.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human PCOLCE protein images

  • ab114788 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human PCOLCE protein (ab114788)

ab114788 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up