Recombinant Human PCP4L1 protein (BSA and azide free) (ab174388)

Overview

  • Product name
    Recombinant Human PCP4L1 protein (BSA and azide free)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSH MGSMSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEK AALAIQGKFRRFQKRKKDPSS
    • Molecular weight
      10 kDa including tags
    • Amino acids
      1 to 68
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_001096036.1)

Specifications

Our Abpromise guarantee covers the use of ab174388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • IQM1
    • PCP4 like protein 1
    • Purkinje cell protein 4 - like protein 1
    • Purkinje cell protein 4 like 1

Images

  • SDS-PAGE analysis PCP4L1 using 3 µg of ab174388 on a 15% gel.

References

ab174388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up