Recombinant Human PCQAP / MED15 protein (ab162601)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAK TRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL
    • Amino acids
      1 to 88
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activator recruited cofactor 105 kD
    • Activator-recruited cofactor 105 kDa component
    • ARC105
    • CAG7A
    • CTG repeat protein 7a
    • CTG7A
    • Mediator complex subunit 15
    • Mediator of RNA polymerase II transcription subunit 15
    • PC2 glutamine rich associated protein
    • PC2 glutamine/Q-rich-associated protein
    • Positive cofactor 2 glutamine/Q-rich-associated protein
    • TIG-1
    • TIG1
    • TNRC7
    • TPA inducible gene 1
    • TPA inducible protein
    • TPA-inducible gene 1 protein
    • Trinucleotide repeat containing 7
    • Trinucleotide repeat containing gene 7 protein
    see all
  • Relevance
    PCQAP / MED15 is a member of the mediator complex that can act as both a positive and negative regulator of transcription. The mediator complex interacts with RNA pol II and its associated proteins, the general transcription factors. Mediator proteins serve as a bridge connecting the activator and basal transcription machinery.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab162601 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up