Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVP YLASYVSPVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTLEHVAVTVS ITHPRRGSLE
    • Amino acids
      434 to 543
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hPC8
    • LPC
    • Lymphoma proprotein convertase
    • PC7
    • PC8
    • Pcsk7
    • PCSK7_HUMAN
    • Prohormone convertase 7
    • Prohormone convertase 8
    • Proprotein convertase 7
    • Proprotein convertase 8
    • Proprotein convertase PC7
    • Proprotein convertase subtilisin/kexin type 7
    • SPC7
    • Subtilisin/kexin-like protease PC7
    see all
  • Function
    Likely to represent a ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RXXX[KR]R consensus motif.
  • Tissue specificity
    Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocyte.
  • Sequence similarities
    Belongs to the peptidase S8 family.
    Contains 1 homo B/P domain.
  • Post-translational
    modifications
    Cysteine residues in the cytoplasmic tail are probably palmitoylated.
    N-glycosylated.
  • Cellular localization
    Golgi apparatus > trans-Golgi network membrane. Seems to be localized intracellularly to the trans Golgi network.
  • Information by UniProt

Images

  • ab160366 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up