Recombinant Human PCTAIRE3 protein (ab179959)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGR DPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMD IRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGE GTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANI VTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRG LAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVV TLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHL IFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLL SSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKD PGYRGLAFQQPGRGKNRRQSIF
    • Molecular weight
      76 kDa including tags
    • Amino acids
      1 to 472
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      BC011526

Specifications

Our Abpromise guarantee covers the use of ab179959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    > 75 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 25% Glycerol, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.29% Sodium chloride, 0.002% PMSF

General Info

  • Alternative names
    • Cdk18
    • CDK18_HUMAN
    • Cell division protein kinase 18
    • Cyclin-dependent kinase 18
    • PCTAIRE
    • PCTAIRE 3
    • PCTAIRE motif protein kinase 3
    • PCTAIRE protein kinase 3
    • PCTAIRE-motif protein kinase 3
    • PCTK 3
    • Serine/threonine-protein kinase PCTAIRE-3
    see all
  • Function
    May play a role in signal transduction cascades in terminally differentiated cells.
  • Tissue specificity
    Isoform 3 expression is limited to several subcortical nuclei of the basal gangli and the spinal cord. Isoform 2 is widely expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab179959.

References

ab179959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up