Recombinant Human PCYT1A protein (ab116777)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49585
    • SpeciesHuman
    • SequenceMDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDE IEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAK NLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAP WTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGI STSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVK KKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALK HMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPAN LSRHKAAAYDISEDEED
    • Molecular weight66 kDa including tags
    • Amino acids1 to 367

Specifications

Our Abpromise guarantee covers the use of ab116777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCT A
    • CCT alpha
    • CCT-alpha
    • Choline phosphate cytidylyltransferase A
    • Choline-phosphate cytidylyltransferase A
    • CT
    • CT A
    • CTP:phosphocholine cytidylyltransferase A
    • CTPCT
    • PCY1A_HUMAN
    • PCYT1
    • Pcyt1a
    • Phosphate cytidylyltransferase 1 choline alpha
    • Phosphate cytidylyltransferase 1 choline alpha isoform
    • Phosphorylcholine transferase A
    see all
  • FunctionControls phosphatidylcholine synthesis.
  • PathwayPhospholipid metabolism; phosphatidylcholine biosynthesis; phosphatidylcholine from phosphocholine: step 1/2.
  • Sequence similaritiesBelongs to the cytidylyltransferase family.
  • Post-translational
    modifications
    The serine residues of the C-terminus are phosphorylated. The inactive soluble form is stabilized by phosphorylation, the active membrane bound form is promoted by anionic lipids or diacylglycerol, and is stabilized by dephosphorylation.
  • Cellular localizationCytoplasm > cytosol. Membrane. It can interconvert between an inactive cytosolic form and an active membrane-bound form.
  • Information by UniProt

Recombinant Human PCYT1A protein images

  • 12.5% SDS-PAGE showing ab116777 at approximately 66.44kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PCYT1A protein (ab116777)

ab116777 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"