Recombinant Human PD-L2 protein (ab164273)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRE RATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWD
    • Amino acids
      22 to 111
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B7 dendritic cell molecule
    • B7-DC
    • B7DC
    • bA574F11.2
    • Btdc
    • Butyrophilin B7 DC
    • Butyrophilin B7-DC
    • Butyrophilin B7DC
    • CD 273
    • CD273
    • CD273 antigen
    • MGC142238
    • MGC142240
    • PD 1 ligand 2
    • PD L2
    • PD-1 ligand 2
    • PD-L2
    • PD1 ligand 2
    • PD1L2_HUMAN
    • PDCD 1 ligand 2
    • PDCD1 ligand 2
    • PDCD1L2
    • Pdcd1lg2
    • PDL 2
    • PDL2
    • Programmed cell death 1 ligand 2
    • Programmed death ligand 2
    see all
  • Function
    Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.
  • Tissue specificity
    Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Secreted; Cell membrane and Endomembrane system.
  • Information by UniProt

Images

  • ab164273 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up