Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15116
    • SpeciesHuman
    • SequenceMQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPALLVVTEGDNA TFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL PNGRDFHMSV
    • Molecular weight38 kDa including tags
    • Amino acids1 to 110

Specifications

Our Abpromise guarantee covers the use of ab114177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD279
    • CD279 antigen
    • hPD 1
    • hPD l
    • hPD-1
    • hSLE1
    • PD 1
    • PD-1
    • PD1
    • PDCD 1
    • PDCD1
    • PDCD1_HUMAN
    • Programmed cell death 1
    • Programmed cell death protein 1
    • Protein PD 1
    • Protein PD-1
    • SLEB2
    • Systemic lupus erythematosus susceptibility 2
    see all
  • FunctionPossible cell death inducer, in association with other factors.
  • Involvement in diseaseGenetic variation in PDCD1 is associated with susceptibility to systemic lupus erythematosus type 2 (SLEB2) [MIM:605218]. Systemic lupus erythematosus is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
  • Sequence similaritiesContains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stageInduced at programmed cell death.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human PD1 protein images

  • ab114177 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human PD1 protein (ab114177)

ab114177 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"