Overview

  • Product name
    Recombinant Human PDAP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD PKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLD LDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQR EEAARKKEEERKAKDDATLSGKRMQSLSLNKLEHHHHHH
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 181
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99246 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • 28 kDa heat- and acid-stable phosphoprotein
    • 28kDa heat and acid stable phosphoprotein
    • HAP28_HUMAN
    • HASPP28
    • PAP
    • PAP1
    • PDAP 1
    • Pdap1
    • PDGF associated protein
    • PDGF-associated protein
    • PDGFA associated protein 1
    • PDGFA-associated protein 1
    see all
  • Function
    Enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
  • Sequence similarities
    Belongs to the PDAP1 family.
  • Information by UniProt

Recombinant Human PDAP1 protein images

  • 15% SDS-PAGE showing ab99246 (3µg).

References for Recombinant Human PDAP1 protein (ab99246)

ab99246 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up