Recombinant Human PDCD10 protein (ab113198)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BUL8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFN ELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLL RMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTI KDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTY FKDGKAINVFVSANRLIHQTNLILQTFKTVA
    • Molecular weight27 kDa including tags
    • Amino acids1 to 212
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    Purity is >95%, by SDS-PAGE and silver stain.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

  • ReconstitutionThe lyophilized ab113198 should be reconstituted in water or PBS to a concentration not lower than 50 µg/ml.

General Info

  • Alternative names
    • Apoptosis related protein 15
    • CCM3
    • Cerebral cavernous malformations 3 protein
    • MGC1212
    • MGC24477
    • PDC10_HUMAN
    • PDCD 10
    • PDCD10
    • Programmed cell death 10
    • Programmed cell death protein 10
    • TF 1 cell apoptosis related protein 15
    • TF-1 cell apoptosis-related protein 15
    • TFAR15
    see all
  • FunctionPromotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development.
  • Tissue specificityUbiquitous.
  • Involvement in diseaseDefects in PDCD10 are the cause of cerebral cavernous malformations type 3 (CCM3) [MIM:603285]. Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and usually present clinically during the 3rd to 5th decade of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters.
  • Sequence similaritiesBelongs to the PDCD10 family.
  • Cellular localizationCytoplasm. Golgi apparatus membrane. Cell membrane. Partially co-localizes with endogenous PXN at the leading edges of migrating cells.
  • Information by UniProt

Recombinant Human PDCD10 protein images

  • SDS-PAGE of recombinant CCM3 (ab113198). The sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with silver stain.

References for Recombinant Human PDCD10 protein (ab113198)

ab113198 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"