Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSSSGLVPRGSHMADEELEALRRQRLAELQAKHGDPGDAAQQEAKHRE AEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEK VSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
    • Molecular weight
      14 kDa
    • Amino acids
      1 to 125
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab172850 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

General Info

  • Alternative names
    • PDCD5
    • PDCD5_HUMAN
    • Programmed cell death protein 5
    • Protein TFAR19
    • TF 1 cell apoptosis related protein 19
    • TF-1 cell apoptosis-related protein 19
    • TFAR19
    • TFAR19 novel apoptosis-related
    see all
  • Function
    May function in the process of apoptosis.
  • Tissue specificity
    Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
  • Sequence similarities
    Belongs to the PDCD5 family.
  • Developmental stage
    Expression in fetal tissues is significantly lower than in adult tissues.
  • Information by UniProt

References

ab172850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up