Overview

  • Product nameRecombinant Human PDCD6 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO75340
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAYSYRPGPGAGPGPAAGAALPDQSFLWN VFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGV NFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQF HDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY EQYLSMVFSIV
    • Molecular weight24 kDa including tags
    • Amino acids1 to 191
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104605 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 10mM Sodium citrate, pH 3.5

General Info

  • Alternative names
    • AIP1
    • ALG 2
    • ALG-2-interacting protein 1
    • ALG2
    • ALIX
    • Apoptosis linked gene 2
    • Apoptosis linked gene 2 protein
    • Apoptosis-linked gene 2 protein
    • FLJ42309
    • FLJ46208
    • Hp95
    • KIAA1375
    • MA 3
    • MA3
    • MGC111017
    • MGC119050
    • MGC9123
    • PDCD 6
    • Pdcd6
    • PDCD6_HUMAN
    • PEF 1B
    • PEF1B
    • Probable calcium binding protein ALG 2
    • Probable calcium binding protein ALG2
    • Probable calcium-binding protein ALG-2
    • Programmed cell death 6
    • Programmed cell death 6-interacting protein
    • Programmed cell death protein 6
    • PS 2
    • PS2
    see all
  • FunctionCalcium-binding protein required for T-cell receptor-, Fas-, and glucocorticoid-induced cell death. May mediate Ca(2+)-regulated signals along the death pathway (By similarity). Calcium-dependent adapter necessary for the association between PDCD6IP and TSG101. Interaction with DAPK1 can accelerate apoptotic cell death by increasing caspase-3 activity. May inhibit KDR/VEGFR2-dependent angiogenesis; the function involves inhibition of VEGF-induced phosphoprylation of the Akt signaling pathway. Seems to play a role in the regulation of the distribution and function of MCOLN1 in the endosomal pathway. Isoform 2 has a lower Ca(2+) affinity than isoform 1. Isoform 1 and, to a lesser extend, isoform 2, can stabilize SHISA5.
  • Sequence similaritiesContains 5 EF-hand domains.
  • Cellular localizationNucleus membrane. Endoplasmic reticulum membrane. Nucleus. Endosome. Interaction with RBM22 induces relocalization from the cytoplasm to the nucleus. Translocated from the cytoplasm to the nucleus after heat shock cell treatment. Accumulates in cytoplasmic vesicle-like organelles after heat shock treatment, which may represent stress granules.
  • Information by UniProt

Recombinant Human PDCD6 protein images

  • 15% SDS-PAGE showing ab104605 (3 µg) at approximately 24 kDa.

References for Recombinant Human PDCD6 protein (ab104605)

ab104605 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"