Recombinant human PDE10A protein (ab101116)

Overview

Description

  • NatureRecombinant
  • SourceBaculovirus
  • Amino Acid Sequence
    • AccessionQ9Y233
    • SpeciesHuman
    • SequenceMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGD ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQ EVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSL LEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTK EIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCM PIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIG PFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHA VTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDH PLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAI IATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTK LWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV AQKAAASED
    • Molecular weight102 kDa including tags
    • Amino acids71 to 779

Specifications

Our Abpromise guarantee covers the use of ab101116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe specific activity of ab101116 was determined to be 92 nmol/min/mg as per activity assay.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 80 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: 0% None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 10A
    • cAMP and cAMP inhibited cGMP 3'5' cyclic phosphodiesterase 10A
    • cAMP and cAMP-inhibited cGMP 3''
    • FLJ11894
    • HSPDE 10A
    • HSPDE10A
    • PDE 10A
    • PDE10_HUMAN
    • Pde10a
    • Phosphodiesterase 10A
    • Phosphodiesterase 10A1
    see all
  • FunctionPlays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. Can hydrolyze both cAMP and cGMP, but has higher affinity for cAMP and is more efficient with cAMP as substrate.
  • Tissue specificityAbundant in the putamen and caudate nucleus regions of brain and testis, moderately expressed in the thyroid gland, pituitary gland, thalamus and cerebellum.
  • PathwayPurine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
    Purine metabolism; 3',5'-cyclic GMP degradation; GMP from 3',5'-cyclic GMP: step 1/1.
  • Sequence similaritiesBelongs to the cyclic nucleotide phosphodiesterase family.
    Contains 2 GAF domains.
  • DomainThe tandem GAF domains bind cAMP, and regulate enzyme activity. The binding of cAMP stimulates enzyme activity.
    Composed of a C-terminal catalytic domain containing two divalent metal sites and an N-terminal regulatory domain which contains one cyclic nucleotide-binding region.
  • Cellular localizationCytoplasm. Located mostly to soluble cellular fractions.
  • Information by UniProt

Recombinant human PDE10A protein images

  • The specific activity of ab101116 was determined to be 92 nmol/min/mg by activity assay.
  • The putity of ab101116 was determined to be >80% by densitometry.

    Approximate MWt: 102kDa

References for Recombinant human PDE10A protein (ab101116)

ab101116 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"