Recombinant human PDE10A protein (ab101116)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGD ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQ EVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSL LEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTK EIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCM PIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIG PFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHA VTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDH PLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAI IATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTK LWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV AQKAAASED
    • Molecular weight
      102 kDa including tags
    • Amino acids
      71 to 779

Specifications

Our Abpromise guarantee covers the use of ab101116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The specific activity of ab101116 was determined to be 92 nmol/min/mg as per activity assay.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: 0% None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 10A
    • cAMP and cAMP inhibited cGMP 3'5' cyclic phosphodiesterase 10A
    • cAMP and cAMP-inhibited cGMP 3''
    • FLJ11894
    • HSPDE 10A
    • HSPDE10A
    • PDE 10A
    • PDE10_HUMAN
    • Pde10a
    • Phosphodiesterase 10A
    • Phosphodiesterase 10A1
    see all
  • Function
    Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. Can hydrolyze both cAMP and cGMP, but has higher affinity for cAMP and is more efficient with cAMP as substrate.
  • Tissue specificity
    Abundant in the putamen and caudate nucleus regions of brain and testis, moderately expressed in the thyroid gland, pituitary gland, thalamus and cerebellum.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
    Purine metabolism; 3',5'-cyclic GMP degradation; GMP from 3',5'-cyclic GMP: step 1/1.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family.
    Contains 2 GAF domains.
  • Domain
    The tandem GAF domains bind cAMP, and regulate enzyme activity. The binding of cAMP stimulates enzyme activity.
    Composed of a C-terminal catalytic domain containing two divalent metal sites and an N-terminal regulatory domain which contains one cyclic nucleotide-binding region.
  • Cellular localization
    Cytoplasm. Located mostly to soluble cellular fractions.
  • Information by UniProt

Images

  • The specific activity of ab101116 was determined to be 92 nmol/min/mg by activity assay.
  • The putity of ab101116 was determined to be >80% by densitometry.

    Approximate MWt: 102kDa

References

ab101116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up