Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVV DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST FTRKMGMTKKKPEEKPKFRSIVHAVQAGIFVERMYRKTYHMVGLAYPAAV IVTLKDVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIPVSCL ITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEIL AMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPE GIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGL PFSPLCDRKSTMVAQSQIGFIDFIVEPTFSLLTDSTEKIVIPLIEEASKA ETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDYSLAAVDLKSF KNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDETHS
    • Amino acids
      1 to 545
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3' 5' cyclic nucleotide phosphodiesterase
    • 5''-cyclic nucleotide phosphodiesterase 1A
    • 61 kDa Cam PDE
    • 61 kDa Cam-PDE
    • Calcium/calmodulin dependent 3' 5' cyclic nucleotide phosphodiesterase 1A
    • Calcium/Calmodulin stimulated cyclic nucleotide phosphodiesterase
    • Calcium/calmodulin-dependent 3''
    • Calmodulin-dependent Phosphodiesterase
    • Cam PDE 1A
    • Cam-PDE 1A
    • CAM-PDE-1A
    • HCAM 1
    • hCam-1
    • HCAM1
    • HSPDE1A
    • MGC26303
    • PDE 1A
    • PDE1A
    • PDE1A_HUMAN
    • Phosphodiesterase 1A
    • Phosphodiesterase 1A calmodulin dependent
    see all
  • Function
    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP.
  • Tissue specificity
    Several tissues, including brain, kidney, testes and heart.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.
  • Information by UniProt

Images

  • ab152595 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152595 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up