Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVS HKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
    • Molecular weight
      36 kDa including tags
    • Amino acids
      850 to 940

Specifications

Our Abpromise guarantee covers the use of ab114923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris buffered saline, 0.3% Glutathione

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase
    • cGMP dependent 3'5' cyclic phosphodiesterase
    • cGMP stimulated phosphodiesterase 1
    • cGMP stimulated phosphodiesterase 4
    • cGMP-dependent 3''
    • cGMP-stimulated phosphodiesterase 2
    • CGS PDE
    • CGS-PDE
    • cGSPDE
    • Cyclic GMP stimulated phosphodiesterase
    • Cyclic GMP-stimulated phosphodiesterase
    • Human cGMP stimulated 3'5' cyclic nucleotide phosphodiesterase
    • PDE 2A
    • PDE 2A1
    • PDE 2A4
    • PDE2A
    • PDE2A_HUMAN
    • PDE2A1
    • PDE2A4
    • phosphodiesterase 2A
    • Phosphodiesterase 2A cGMP stimulated
    see all
  • Function
    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
  • Tissue specificity
    Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.
    Contains 2 GAF domains.
  • Domain
    GAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114923 at approximately 35.64kDa.
    Stained with Coomassie Blue.

References

ab114923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up