Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00408
    • SpeciesHuman
    • SequenceREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVS HKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
    • Molecular weight36 kDa including tags
    • Amino acids850 to 940

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris buffered saline, 0.3% Glutathione

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase
    • cGMP dependent 3'5' cyclic phosphodiesterase
    • cGMP stimulated phosphodiesterase 1
    • cGMP stimulated phosphodiesterase 4
    • cGMP-dependent 3''
    • cGMP-stimulated phosphodiesterase 2
    • CGS PDE
    • CGS-PDE
    • cGSPDE
    • Cyclic GMP stimulated phosphodiesterase
    • Cyclic GMP-stimulated phosphodiesterase
    • Human cGMP stimulated 3'5' cyclic nucleotide phosphodiesterase
    • PDE 2A
    • PDE 2A1
    • PDE 2A4
    • PDE2A
    • PDE2A_HUMAN
    • PDE2A1
    • PDE2A4
    • phosphodiesterase 2A
    • Phosphodiesterase 2A cGMP stimulated
    see all
  • FunctionCyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
  • Tissue specificityExpressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.
  • Sequence similaritiesBelongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.
    Contains 2 GAF domains.
  • DomainGAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human PDE2A protein images

  • 12.5% SDS-PAGE showing ab114923 at approximately 35.64kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PDE2A protein (ab114923)

ab114923 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"