Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPP VICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSD SSDIVQNE
    • Molecular weight
      38 kDa including tags
    • Amino acids
      533 to 640

Specifications

Our Abpromise guarantee covers the use of ab114728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris buffered saline

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase A
    • cAMP phosphodiesterase myocardial cGMP inhibited
    • CGI PDE
    • CGI PDE A
    • CGI-PDE A
    • cGMP inhibited 3' 5' cyclic phosphodiesterase A
    • cGMP-inhibited 3''
    • Cyclic GMP inhibited phosphodiesterase A
    • Cyclic GMP-inhibited phosphodiesterase A
    • Human cGMP inhibited cAMP phosphodiesterase mRNA
    • PDE 3A
    • Pde3a
    • PDE3A_HUMAN
    • Phosphodiesterase 3A
    • Phosphodiesterase 3A cGMP inhibited
    see all
  • Function
    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE3 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up