Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPP VICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSD SSDIVQNE
    • Molecular weight
      38 kDa including tags
    • Amino acids
      533 to 640

Specifications

Our Abpromise guarantee covers the use of ab114728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris buffered saline

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase A
    • cAMP phosphodiesterase myocardial cGMP inhibited
    • CGI PDE
    • CGI PDE A
    • CGI-PDE A
    • cGMP inhibited 3' 5' cyclic phosphodiesterase A
    • cGMP-inhibited 3''
    • Cyclic GMP inhibited phosphodiesterase A
    • Cyclic GMP-inhibited phosphodiesterase A
    • Human cGMP inhibited cAMP phosphodiesterase mRNA
    • PDE 3A
    • Pde3a
    • PDE3A_HUMAN
    • Phosphodiesterase 3A
    • Phosphodiesterase 3A cGMP inhibited
    see all
  • Function
    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE3 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human PDE3A protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human PDE3A protein (ab114728)

ab114728 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up