Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPV EQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
    • Amino acids
      401 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase B
    • Adipocyte cAMP phosphodiesterase cGMP inhibited
    • AI847709
    • cAMP Phosphodiesterase, adipocyte, cGMP-inhibited
    • CGI-PDE B
    • CGIP1
    • CGIPDE B
    • CGIPDE1
    • cGMP inhibited 3 5 cyclic phosphodiesterase B
    • CGMP inhibited cAMP phophodiesterase
    • cGMP-inhibited 3''
    • Cyclic GMP inhibited phosphodiesterase B
    • Cyclic GMP-inhibited phosphodiesterase B
    • Cyclic nucleotide phosphodiesterase
    • HcGIP1
    • HcGIP1, rat, homolog of
    • Pde3b
    • PDE3B_HUMAN
    • Phosphodiesterase 3B
    • Phosphodiesterase 3B cGMP inhibited
    see all
  • Function
    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. May play a role in fat metabolism.
  • Tissue specificity
    Abundant in adipose tissues.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE3 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab152597 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up