Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPLVDFFCETCSKPWLVGWWDQFKRMLNRELTHLSEMSRSGNQVSEYIST TFLDKQNEVEIPSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLK KLMHSNSLNNSNIPRFGVKTDQEELLAQELENLNKWGLNIFCVSDYAGGR SLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAA DVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTN SELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVID MVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHC ADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVE KSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWYYSAIRQSPSP PPEEESRGPGHPPLPDKFQFELTLEEEEEEEISMAQIPCTAQEALTAQGL SGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLTQQAQSTGSA PVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGL PSTAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
    • Molecular weight
      97 kDa including tags
    • Amino acids
      1 to 647
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 4A
    • cAMP specific phosphodiesterase
    • cAMP-specific 3''
    • cAMP-specific 3',5'-cyclic phosphodiesterase 4A
    • DPDE2
    • dunce like phosphodiesterase E2
    • PDE 4A
    • PDE4
    • PDE46
    • PDE4A
    • PDE4A_HUMAN
    • PDE4A11
    • Phosphodiesterase 4A
    • phosphodiesterase 4A cAMP specific
    • Phosphodiesterase 4A, cAMP-specific (dunce
    • phosphodiesterase E2 dunce homolog
    • Phosphodiesterase E2 dunce homolog, Drosophila
    • phosphodiesterase isozyme 4
    • phosphodiesterase type 4A11
    see all
  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
  • Tissue specificity
    Isoform 1 is widely expressed. Isoform 2 is abundant in liver, stomach, testis, thyroid and adrenal glands. It is also found in placenta, kidney, pancreas, ovary, uterus, skin, monocytes, mast cells, macrophages, as well as in bronchial smooth muscle. Isoform 6 is expressed at high levels in the heart and small intestine. It is also found in the brain, kidney, spleen, colon, salivary gland, ovary and peripheral blood lymphocytes. Isoform 7 is expressed predominantly in skeletal muscle and brain and at lower levels in the testis. Isoform 7 is expressed in the brain. Found in specific neuronal subpopulations in cortex, spinal cord and cerebellum (at protein level).
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
  • Post-translational
    modifications
    Phosphorylated at Ser-686 and Ser-688 when expressed in S.frugiperda cells. Isoform 2 and isoform 7 are activated by phosphorylation at Ser-119 and Ser-123 respectively by PKA.
    Proteolytically cleaved by caspase-3.
  • Cellular localization
    Cytoplasm > perinuclear region; Cytoplasm > perinuclear region. Cell projection > ruffle membrane; Cytoplasm. Membrane. Predominantly cytoplasmic and Membrane. Isoform 4 has propensity for association with membranes.
  • Information by UniProt

Recombinant Human PDE4A protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117037 at approximately 97.24 kDa.

References for Recombinant Human PDE4A protein (ab117037)

ab117037 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up