Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDE EDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT
    • Amino acids
      637 to 736
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 4B
    • cAMP-specific 3''
    • cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    • cAMP-specific phosphodiesterase-4 B isoform
    • DKFZp686F2182
    • DPDE4
    • dunce-like phosphodiesterase E4
    • MGC126529
    • OTTHUMP00000010652
    • OTTHUMP00000010653
    • OTTHUMP00000010654
    • OTTHUMP00000010656
    • OTTHUMP00000232365
    • PDE 4B
    • PDE IVB
    • PDE32
    • Pde4b
    • PDE4B_HUMAN
    • PDE4B5
    • PDEIVB
    • Phosphodiesterase 4B
    • Phosphodiesterase 4B cAMP specific
    • Phosphodiesterase 4B, cAMP specific (phosphodiesterase E4 dunce homolog, Drosophila)
    see all
  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in mediating central nervous system effects of therapeutic agents ranging from antidepressants to antiasthmatic and anti-inflammatory agents.
  • Tissue specificity
    Expressed in brain, heart, lung and skeletal muscle.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
  • Information by UniProt

Images

  • ab159072 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up