Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPEANYLLSVSWGYIKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQ HEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNSSIPRFGVKTEQE DVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPV DTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLE ILAAIFASAIHDVDHPGVFNQFLINTNSELALMYNDSSVLENHHLAVGFK LLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVET KKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEE FFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVH PDAQDILDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLE EDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVGE EEESQPEACVIDDRSPDT
    • Amino acids
      1 to 518
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cAMP specific 3',5' cyclic phosphodiesterase 4D
    • DKFZp686M11213
    • 5''-cyclic phosphodiesterase 4D
    • cAMP specific phosphodiesterase 4D
    • cAMP specific phosphodiesterase PDE4D6
    • cAMP-specific 3''
    • DPDE3
    • Dunce like phosphodiesterase E3
    • FLJ97311
    • HSPDE4D
    • PDE43
    • Pde4d
    • PDE4D_HUMAN
    • PDE4DN2
    • Phosphodiesterase 4D cAMP specific
    • Phosphodiesterase 4D cAMP specific (dunce (Drosophila) homolog phosphodiesterase E3)
    • Phosphodiesterase 4D cAMP specific (phosphodiesterase E3 dunce homolog Drosophila)
    • Phosphodiesterase 4D, cAMP specific (dunce)
    • STRK1
    see all
  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
  • Tissue specificity
    Widespread; most abundant in skeletal muscle. Isoform 6 is detected in brain. Isoform 8 is detected in brain, placenta, lung and kidney. Isoform 7 is detected in heart and skeletal muscle.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Involvement in disease
    Note=Genetic variations in PDE4D might be associated with susceptibility to stroke. PubMed:17006457 states that association with stroke has to be considered with caution.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
  • Post-translational
    modifications
    Isoform 3 and isoform 7 are activated by phosphorylation (in vitro), but not isoform 6. Isoform N3 and isoform 12 are phosphorylated on Ser-49, Ser-51, Ser-55 and Ser-59.
  • Cellular localization
    Cytoplasm. Membrane. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Found in the soluble fraction, associated with membranes, and associated with the cytoskeleton and the centrosome.
  • Information by UniProt

Images

  • ab159074 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up