Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EINQVAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSE LTQVEESALCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      3 to 100

Specifications

Our Abpromise guarantee covers the use of ab116895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase subunit alpha''
    • cGMP phosphodiesterase 6C
    • COD4
    • Cone cGMP specific 3' 5' cyclic phosphodiesterase subunit alpha'
    • Cone cGMP-specific 3''
    • PDE 6C
    • PDE6 alpha prime
    • PDE6 alpha'
    • PDE6C
    • PDE6C_HUMAN
    • PDEA2
    • Phosphodiesterase 6C cGMP specific cone alpha prime
    see all
  • Involvement in disease
    Defects in PDE6C are the cause of cone dystrophy type 4 (COD4) [MIM:613093]. An early-onset cone dystrophy. Cone dystrophies are retinal dystrophies characterized by progressive degeneration of the cone photoreceptors with preservation of rod function, as indicated by electroretinogram. However, some rod involvement may be present in some cone dystrophies, particularly at late stage. Affected individuals suffer from photophobia, loss of visual acuity, color vision and central visual field. Another sign is the absence of macular lesions for many years. Cone dystrophies are distinguished from the cone-rod dystrophies in which some loss of peripheral vision also occurs.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family.
    Contains 2 GAF domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116895 at approximately 36.41kDa stained with Coomassie Blue.

References

ab116895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up