Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDI PGMEGLGTDITVICPWEAFSHLELHELAQFGII
    • Amino acids
      1 to 83
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase subunit gamma
    • CNCG_HUMAN
    • GMP-PDE gamma
    • Pde6h
    • Retinal cone rhodopsin-sensitive cGMP 3''
    see all
  • Function
    Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.
  • Involvement in disease
    Defects in PDE6H are the cause of cone dystrophy retinal type 3A (RCD3A) [MIM:610024]; also known as cone dystrophy with night blindness and supernormal rod responses. RCD3A is a rare form of cone dystrophy associated with supernormal rod responses. The disorder is characterized by reduced visual acuity, photoaversion, night blindness, and abnormal color vision. At an early age, the retina shows subtle depigmentation at the macula and, later, more obvious areas of atrophy.
  • Sequence similarities
    Belongs to the rod/cone cGMP-PDE gamma subunit family.
  • Domain
    The C-terminal region is important in conferring inhibition.
  • Information by UniProt

Images

  • ab159076 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159076 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up