Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRF LVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLI AAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESG LFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDT RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLG VSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLN KASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS
    • Amino acids
      122 to 456

Specifications

Our Abpromise guarantee covers the use of ab79740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific Activity: 350 pmol/min/µg.
  • Applications

    Functional Studies

    SDS-PAGE

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50% Glycerol, 0.05% Tween 20, 3mM DTT, 25mM Tris HCl, 100mM Sodium chloride, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 7A
    • HCP 1
    • HCP1
    • High affinity cAMP specific 3'5' cyclic phosphodiesterase 7A
    • High affinity cAMP-specific 3''
    • P2A
    • PDE 7
    • PDE 7A
    • PDE1/PDE2 yeast human complement of
    • PDE7
    • PDE71
    • PDE7A
    • PDE7A_HUMAN
    • Phosphodiesterase 7A
    • Phosphodiesterase isozyme 7
    • Phosphodiesterase7A
    • Rolipram insensitive phosphodiesterase type 7
    • TM 22
    • TM22
    see all
  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction.
  • Tissue specificity
    PDE7A1 is found at high levels in skeletal muscle and at low levels in a variety of tissues including brain and heart. It is expressed as well in two T-cell lines. PDE7A2 is found abundantly in skeletal muscle and at low levels in heart.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE7 subfamily.
  • Developmental stage
    Developmentally regulated. PDE7A1 and PDE7A2 are found in several fetal tissues, expression is reduced throughout development. It persists strongly only in adult skeletal muscle.
  • Domain
    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.
  • Cellular localization
    Cytoplasm > cytosol. PDE7A1 (57 kDa) is located mostly to soluble cellular fractions and Cytoplasm. PDE7A2 (50 kDa) is located to particulate cellular fractions.
  • Information by UniProt

Images

  • 10% SDS-PAGE showing ab79740 at approximately 66kDa (1µg).

References

ab79740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab79740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up