Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFID FRLLNSTTYSGEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDED
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA472E5.1
    • cAMP specific 3 5 cyclic phosphodiesterase 7B
    • cAMP specific 3'5' cyclic phosphodiesterase 7B
    • High affinity cAMP specific 3 5 cyclic phosphodiesterase
    • High affinity cAMP specific 3'5' cyclic phosphodiesterase
    • MGC88256
    • OTTHUMP00000017267
    • PDE 7B
    • PDE7B protein
    • Phosphodiesterase 7B
    • Phosphodiesterase7B
    • RNPDE7B
    • Rolipram insensitive phosphodiesterase type 7
    see all
  • Relevance
    PDE7B is a cAMP specific phosphodiesterase. The cAMP-specific phosphodiesterase type-7 (PDE7) family is comprised of 2 genes (PDE7A and PDE7B) each with multiple splice variants generated by RNA splicing and use of alternate initiation sites. PDE7B has three splice variants (PDE7B1 = 446 amino acid; PDE7B2 =359 amino acids and PDE7B3 = 459 amino acids. Both PDE7B2 ad PDE7B3 posses unique N-terminal sequences. PDE7B is expressed in various tissues including skeletal muscle, heart, lung and testis. PDE7B may be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain.
  • Cellular localization
    cytosol

Images

  • ab162083 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up