Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQ VLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      32 to 121

Specifications

Our Abpromise guarantee covers the use of ab114643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 8A
    • cAMP specific cyclic nucleotide phosphodiesterase 8A
    • FLJ16150
    • High affinity cAMP specific and IBMX insensitive 3'5' cyclic phosphodiesterase 8A
    • High affinity cAMP-specific and IBMX-insensitive 3''
    • HsT19550
    • PDE 8A
    • PDE8A
    • PDE8A_HUMAN
    • Phosphodiesterase 8A
    • Phosphodiesterase8A
    • Weakly similar to 3'5' cyclic nucleotide phosphodiesterase
    see all
  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development.
  • Tissue specificity
    Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Domain
    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab114643 Stained with Coomassie Blue.

References

ab114643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up