Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQ VLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      32 to 121

Specifications

Our Abpromise guarantee covers the use of ab114643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 8A
    • cAMP specific cyclic nucleotide phosphodiesterase 8A
    • FLJ16150
    • High affinity cAMP specific and IBMX insensitive 3'5' cyclic phosphodiesterase 8A
    • High affinity cAMP-specific and IBMX-insensitive 3''
    • HsT19550
    • PDE 8A
    • PDE8A
    • PDE8A_HUMAN
    • Phosphodiesterase 8A
    • Phosphodiesterase8A
    • Weakly similar to 3'5' cyclic nucleotide phosphodiesterase
    see all
  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development.
  • Tissue specificity
    Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Domain
    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.
  • Information by UniProt

Recombinant Human PDE8A protein images

  • 12.5% SDS-PAGE image showing ab114643 Stained with Coomassie Blue.

References for Recombinant Human PDE8A protein (ab114643)

ab114643 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up