Recombinant human PDGF B protein (His tag) (ab221402)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCS GCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCE TVAAARPVT
    • Molecular weight
      15 kDa including tags
    • Amino acids
      82 to 190
    • Tags
      His tag C-Terminus , proprietary tag C-Terminus
    • Additional sequence information
      Mature protein without signal and propeptides.

Specifications

Our Abpromise guarantee covers the use of ab221402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Immobilized Human PDGF-BB, His Tag  (ab221402) at 5 µg/mL (100 µl/well) can bind Human PDGF R beta with a linear range of 0.02-1.2 µg/mL.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 5% Trehalose

    Acetonitrile and TFA.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Becaplermin
    • c sis
    • FLJ12858
    • Oncogene SIS
    • PDGF 2
    • PDGF B chain
    • PDGF Beta
    • PDGF subunit B
    • PDGF-2
    • PDGF2
    • Pdgfb
    • PDGFB_HUMAN
    • Platelet derived growth factor 2
    • Platelet derived growth factor B chain
    • Platelet derived growth factor beta
    • Platelet derived growth factor beta polypeptide
    • Platelet derived growth factor beta polypeptide (oncogene SIS)
    • Platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog)
    • Platelet-derived growth factor B chain
    • Platelet-derived growth factor beta polypeptide
    • Platelet-derived growth factor subunit B
    • Proto-oncogene c-Sis
    • Simian sarcoma viral (v sis) oncogene homolog
    • SIS
    • SSV
    • v sis platelet derived growth factor beta polypeptide
    see all
  • Information by UniProt

Images

  • Immobilized Human PDGF-BB, His Tag at 5 µg/mL (100 µl/well) can bind ab221402 with a linear range of 0.02-1.2 µg/mL.

  • SDS-PAGE using ab221402. The protein migrates as 17 kDa under reducing (Lane 1) conditions and 35 kDa under non-reducing (Lane 2) conditions.

References

ab221402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up