Recombinant Human PDGF BB protein (ab203721)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCKTRTEVFEISRRLIDRTNANFLVWPPCV EVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDH LACKCETVAAARPVTRSPGGSQEQRAKTPQ
    • Molecular weight
      15 kDa including tags
    • Amino acids
      82 to 190
    • Tags
      His tag N-Terminus
    • Additional sequence information
      This product is for the mature full length protein. The signal peptide and propeptide are not included. NP_148937.

Specifications

Our Abpromise guarantee covers the use of ab203721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab203721 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names
    • Becaplermin
    • c sis
    • FLJ12858
    • Oncogene SIS
    • PDGF 2
    • PDGF B chain
    • PDGF Beta
    • PDGF subunit B
    • PDGF-2
    • PDGF2
    • Pdgfb
    • PDGFB_HUMAN
    • Platelet derived growth factor 2
    • Platelet derived growth factor B chain
    • Platelet derived growth factor beta
    • Platelet derived growth factor beta polypeptide
    • Platelet derived growth factor beta polypeptide (oncogene SIS)
    • Platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog)
    • Platelet-derived growth factor B chain
    • Platelet-derived growth factor beta polypeptide
    • Platelet-derived growth factor subunit B
    • Proto-oncogene c-Sis
    • Simian sarcoma viral (v sis) oncogene homolog
    • SIS
    • SSV
    • v sis platelet derived growth factor beta polypeptide
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab203721 (3µg).

References

ab203721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up