Recombinant Human PDGF Receptor alpha protein (ab109932)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHAHTGLYTCYYNHTQTEENELEGRHIYIYVP DPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASY DSRQGFNGTFMQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMS EEESSDVEIRNEENNSGLFVTVLEVSSASATVGPYICEATVKGKKFQTIP FNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGE VKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVKEM KKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKN NLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAV KSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKD IKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCL AKNLLGAENRELKLVAPTLRSE
    • Molecular weight
      58 kDa including tags
    • Amino acids
      24 to 524
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109932 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab109932 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • Alpha-type platelet-derived growth factor receptor
    • CD140 antigen-like family member A
    • CD140a
    • CD140a antigen
    • MGC74795
    • PDGF alpha chain
    • PDGF-R-alpha
    • PDGFR 2
    • PDGFR alpha
    • PDGFR2
    • PDGFRA
    • PDGFRA/BCR fusion
    • PGFRA_HUMAN
    • Platelet derived growth factor receptor
    • Platelet derived growth factor receptor 2
    • Platelet derived growth factor receptor alpha
    • Platelet derived growth factor receptor alpha polypeptide
    • Rearranged in hypereosinophilia platelet derived growth factor receptor alpha fusion protein
    • RHEPDGFRA
    see all
  • Function
    Receptor that binds both PDGFA and PDGFB and has a tyrosine-protein kinase activity.
  • Tissue specificity
    Expressed in primary and metastatic colon tumors and in normal colon tissue. Tumors may express a different isoform to that found in normal tissue.
  • Involvement in disease
    Note=A chromosomal aberration involving PDGFRA is found in some cases of hypereosinophilic syndrome. Interstitial chromosomal deletion del(4)(q12q12) causes the fusion of FIP1L1 and PDGFRA (FIP1L1-PDGFRA).
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109932 at approximately 58.4 kDa (3µg).

References

ab109932 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109932.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up