Recombinant Human PDGF Receptor alpha protein (ab109932)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHAHTGLYTCYYNHTQTEENELEGRHIYIYVP DPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASY DSRQGFNGTFMQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMS EEESSDVEIRNEENNSGLFVTVLEVSSASATVGPYICEATVKGKKFQTIP FNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGE VKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVKEM KKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKN NLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAV KSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKD IKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCL AKNLLGAENRELKLVAPTLRSE
    • Molecular weight
      58 kDa including tags
    • Amino acids
      24 to 524
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109932 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab109932 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • Alpha-type platelet-derived growth factor receptor
    • CD140 antigen-like family member A
    • CD140a
    • CD140a antigen
    • MGC74795
    • PDGF alpha chain
    • PDGF-R-alpha
    • PDGFR 2
    • PDGFR alpha
    • PDGFR2
    • PDGFRA
    • PDGFRA/BCR fusion
    • PGFRA_HUMAN
    • Platelet derived growth factor receptor
    • Platelet derived growth factor receptor 2
    • Platelet derived growth factor receptor alpha
    • Platelet derived growth factor receptor alpha polypeptide
    • Rearranged in hypereosinophilia platelet derived growth factor receptor alpha fusion protein
    • RHEPDGFRA
    see all
  • Function
    Receptor that binds both PDGFA and PDGFB and has a tyrosine-protein kinase activity.
  • Tissue specificity
    Expressed in primary and metastatic colon tumors and in normal colon tissue. Tumors may express a different isoform to that found in normal tissue.
  • Involvement in disease
    Note=A chromosomal aberration involving PDGFRA is found in some cases of hypereosinophilic syndrome. Interstitial chromosomal deletion del(4)(q12q12) causes the fusion of FIP1L1 and PDGFRA (FIP1L1-PDGFRA).
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human PDGF Receptor alpha protein images

  • 15% SDS-PAGE showing ab109932 at approximately 58.4 kDa (3µg).

References for Recombinant Human PDGF Receptor alpha protein (ab109932)

ab109932 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109932.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up