Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGRNWRWFHSTQ WLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVV TLDASDDGI
    • Amino acids
      1 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159937 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dihydrolipoamide dehydrogenase binding protein of pyruvate dehydrogenase complex
    • Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
    • DLDBP
    • E3 binding protein
    • E3-binding protein
    • E3BP
    • Lipoyl containing pyruvate dehydrogenase complex component X
    • Lipoyl-containing pyruvate dehydrogenase complex component X
    • mitochondrial
    • ODPX_HUMAN
    • OPDX
    • PDHX
    • PDX 1
    • PDX1
    • Pro X
    • proX
    • Pyruvate dehydrogenase complex component X
    • Pyruvate dehydrogenase complex lipoyl containing component X
    • Pyruvate dehydrogenase complex, E3 binding protein subunit
    • Pyruvate dehydrogenase protein X component
    • Pyruvate dehydrogenase protein X component mitochondrial
    see all
  • Function
    Required for anchoring dihydrolipoamide dehydrogenase (E3) to the dihydrolipoamide transacetylase (E2) core of the pyruvate dehydrogenase complexes of eukaryotes. This specific binding is essential for a functional PDH complex.
  • Involvement in disease
    Defects in PDHX are the cause of pyruvate dehydrogenase E3-binding protein deficiency (PDHXD) [MIM:245349].
  • Sequence similarities
    Belongs to the 2-oxoacid dehydrogenase family.
    Contains 1 lipoyl-binding domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab159937 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159937 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159937.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up