Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACE RTSFAFLRQELPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLV EFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPV TNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSIDPNCDV VAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHH MLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNL YSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSR EPKNLAKEVAM
    • Molecular weight
      71 kDa including tags
    • Amino acids
      1 to 411
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4
    • FLJ40832
    • mitochondrial
    • Pdk4
    • PDK4_HUMAN
    • Pyruvate dehydrogenase [lipoamide] kinase isozyme 4 mitochondrial
    • Pyruvate dehydrogenase kinase 4
    • Pyruvate dehydrogenase kinase isoenzyme 4
    • Pyruvate dehydrogenase kinase isoform 4
    • Pyruvate dehydrogenase kinase isozyme 4
    • Pyruvate dehydrogenase kinase isozyme 4 mitochondrial
    see all
  • Function
    Inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
  • Tissue specificity
    Ubiquitous; highest levels of expression in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the PDK/BCKDK protein kinase family.
    Contains 1 histidine kinase domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Recombinant Human PDK4 protein images

  • ab112337 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human PDK4 protein (ab112337)

ab112337 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up