Recombinant Human PDLIM1 protein (ab152952)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SAMPFTASPASSTTARVITNQYNNPAGLYSSENISNFNNALESKTAASGV EANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEI LESEEKGDPN
    • Amino acids
      123 to 232
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C terminal LIM domain protein 1
    • C-terminal LIM domain protein 1
    • Carboxy terminal LIM domain protein 1
    • CLIM 1
    • CLIM1
    • CLP 36
    • CLP36
    • Elfin
    • Enigma
    • Enigma homolog
    • hCLIM 1
    • hCLIM1
    • LIM domain protein CLP 36
    • LIM domain protein CLP-36
    • LIM domain protein CLP36
    • PDLI1_HUMAN
    • PDLIM 1
    • Pdlim1
    • PDZ and LIM domain 1
    • PDZ and LIM domain protein 1
    see all
  • Function
    Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton.
  • Tissue specificity
    Strongly expressed in the heart and skeletal muscle, moderately expressed in the spleen, small intestine, colon, placenta, and lung. A lower level expression is seen in liver, thymus, kidney, prostate and pancreas and is not found in the brain, testis, ovary, and peripheral blood leukocytes.
  • Sequence similarities
    Contains 1 LIM zinc-binding domain.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Associates with the actin stress fibers.
  • Information by UniProt

Images

  • ab152952 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up