Overview

  • Product name
    Recombinant Human PDS5B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGR KKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASES
    • Amino acids
      1168 to 1259
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI646570
    • Androgen induced proliferation inhibitor
    • Androgen-induced prostate proliferative shutoff associated protein AS3
    • APRIN
    • AS3
    • AW212954
    • CG008
    • FLJ23236
    • KIAA0979
    • mKIAA0979
    • PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
    • Pds5b
    • RP1 267P19.1
    • Sister chromatid cohesion protein PDS5 homolog B
    see all
  • Relevance
    PDS5B, also known as APRIN (Androgen induced proliferation inhibitor) plays a role in androgen-induced proliferative arrest in prostate cells and is required for maintenance of sister chromatid cohesion during mitosis.
  • Cellular localization
    Nuclear

Images

  • ab153203 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up